SCOPe 2.08: Domain d6jo59_: 6jo5 9:

Lineage for d6jo59_ (6jo5 9:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370435] (9 PDB entries)

8. Domain d6jo59_: 6jo5 9: [370545]
   Other proteins in same PDB: d6jo5a_, d6jo5b_, d6jo5c_, d6jo5d_, d6jo5e_, d6jo5f_, d6jo5j_, d6jo5l_
   automated match to d5l8r4_
   complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo59_

PDB Entry: 6jo5, 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i

PDB Compounds: (9:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d6jo59_:

Sequence, based on SEQRES records:

>d6jo59_ f.43.1.0 (9:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
twlpglnppahlkgalagdngfdplglgqdegrlkwyaeaektngrwammavagilgqel
lgvtpawweagakeydipaqaltpiefivmgfleikryqgfkqtgtsgfinsfpfdpagm
nspsmatkevkngrlamvafigfcvqalatrtqpiegltahladpfgknityylthlpet
l

Sequence, based on observed residues (ATOM records):

>d6jo59_ f.43.1.0 (9:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
twlpglnppagdngfdplglgqdegrlkwyaeaektngrwammavagilgqellpawwea
gakeydipaqaltpiefivmgfleikryqgfnspsmatkevkngrlamvafigfcvqala
trtqpiegltahladpfgknityylthlpetl

Timeline for d6jo59_:

• d6jo59_ first appeared in SCOPe 2.07