Lineage for d6j8ml_ (6j8m L:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
    automatically mapped to Pfam PF02935
  5. Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. Species Cow (Bos taurus) [TaxId:9913] [81424] (50 PDB entries)
  8. Domain d6j8ml_: 6j8m L: [370478]
    Other proteins in same PDB: d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mo2, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8mz_
    automated match to d1v54l_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d6j8ml_

PDB Entry: 6j8m (more details), 1.9 Å

PDB Description: low-dose structure of bovine heart cytochrome c oxidase in the fully oxidized state determined using 30 kev x-ray
PDB Compounds: (L:) Cytochrome c oxidase subunit 7C

SCOPe Domain Sequences for d6j8ml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j8ml_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d6j8ml_ are not available.

Timeline for d6j8ml_: