SCOPe 2.08: Domain d6jo6f_: 6jo6 F:

Lineage for d6jo6f_ (6jo6 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families)
   automatically mapped to Pfam PF02507

5. Family f.23.16.0: automated matches [276195] (1 protein)
   not a true family

6. Protein automated matches [276199] (5 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370452] (7 PDB entries)

8. Domain d6jo6f_: 6jo6 F: [370453]
   Other proteins in same PDB: d6jo61_, d6jo63_, d6jo64_, d6jo65_, d6jo67_, d6jo68_, d6jo6a_, d6jo6b_, d6jo6c_, d6jo6d_, d6jo6e_, d6jo6j_, d6jo6l_, d6jo6z_
   automated match to d5l8rf_
   complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo6f_

PDB Entry: 6jo6, 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i

PDB Compounds: (F:) Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic

SCOPe Domain Sequences for d6jo6f_:

Sequence; same for both SEQRES and ATOM records:

>d6jo6f_ f.23.16.0 (F:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
diagltpcseskayaklekkelktlekrlkqyeadsapavalkatmertkarfanyakag
llcgndglphliadpglalkyghagevfiptfgflyvagyigyvgrqyliavkgeakptd
keiiidvplatklawqgagwplaavqelqrgtllekeenitvspr

Timeline for d6jo6f_:

• d6jo6f_ first appeared in SCOPe 2.07