SCOPe 2.07: Domain d6j8mz_: 6j8m Z:

Lineage for d6j8mz_ (6j8m Z:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)
   automatically mapped to Pfam PF02285

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81428] (29 PDB entries)

8. Domain d6j8mz_: 6j8m Z: [370341]
   Other proteins in same PDB: d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mn_, d6j8mo1, d6j8mo2, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_
   automated match to d1v54m_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d6j8mz_

PDB Entry: 6j8m, 1.9 Å

PDB Description: low-dose structure of bovine heart cytochrome c oxidase in the fully oxidized state determined using 30 kev x-ray

PDB Compounds: (Z:) Cytochrome c oxidase subunit 8B

SCOPe Domain Sequences for d6j8mz_:

Sequence; same for both SEQRES and ATOM records:

>d6j8mz_ f.23.7.1 (Z:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d6j8mz_:

• d6j8mz_ is new in SCOPe 2.07-stable
  
• d6j8mz_ appears in the current release, SCOPe 2.08