SCOPe 2.07: Domain d6i4mg1: 6i4m G:1-125

Lineage for d6i4mg1 (6i4m G:1-125)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein automated matches [226883] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries)

8. Domain d6i4mg1: 6i4m G:1-125 [370217]
   Other proteins in same PDB: d6i4ma1, d6i4ma2, d6i4mg2
   automated match to d4cbug_
   complexed with adp, ca, mg, scn

Details for d6i4mg1

PDB Entry: 6i4m, 1.87 Å

PDB Description: crystal structure of plasmodium berghei actin ii in the mg-adp state

PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d6i4mg1:

Sequence; same for both SEQRES and ATOM records:

>d6i4mg1 d.109.1.1 (G:1-125) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlangnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkgg
vasgf

Timeline for d6i4mg1:

• d6i4mg1 is new in SCOPe 2.07-stable
  
• d6i4mg1 appears in the current release, SCOPe 2.08