Lineage for d6i4hg_ (6i4h G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969841Protein automated matches [226883] (2 species)
    not a true protein
  7. 2969848Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries)
  8. 2969853Domain d6i4hg_: 6i4h G: [370215]
    Other proteins in same PDB: d6i4ha1, d6i4ha2
    automated match to d4cbug_
    complexed with atp, ca, cl, peg; mutant

Details for d6i4hg_

PDB Entry: 6i4h (more details), 1.4 Å

PDB Description: crystal structure of plasmodium falciparum actin i (f54y mutant) in the ca-atp state
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d6i4hg_:

Sequence, based on SEQRES records: (download)

>d6i4hg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggva
sgf

Sequence, based on observed residues (ATOM records): (download)

>d6i4hg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlgnlqydlhyw
lgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggvasg
f

SCOPe Domain Coordinates for d6i4hg_:

Click to download the PDB-style file with coordinates for d6i4hg_.
(The format of our PDB-style files is described here.)

Timeline for d6i4hg_: