Lineage for d6hr2d_ (6hr2 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501137Protein Elongin B [54246] (2 species)
  7. 2501138Species Human (Homo sapiens) [TaxId:9606] [54247] (49 PDB entries)
  8. 3070141Domain d6hr2d_: 6hr2 D: [370203]
    Other proteins in same PDB: d6hr2a_, d6hr2b_, d6hr2c1, d6hr2c2, d6hr2e_, d6hr2f_, d6hr2g1, d6hr2g2
    automated match to d1lqba_
    complexed with dms, edo, fwz

Details for d6hr2d_

PDB Entry: 6hr2 (more details), 1.76 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca4 and pvhl:elonginc:elonginb
PDB Compounds: (D:) Elongin-B

SCOPe Domain Sequences for d6hr2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hr2d_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOPe Domain Coordinates for d6hr2d_:

Click to download the PDB-style file with coordinates for d6hr2d_.
(The format of our PDB-style files is described here.)

Timeline for d6hr2d_: