| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (63 species) not a true protein |
| Species Plasmodium berghei [TaxId:5823] [370199] (1 PDB entry) |
| Domain d6i4ma2: 6i4m A:147-376 [370201] Other proteins in same PDB: d6i4mg1, d6i4mg2 automated match to d1c0fa2 complexed with adp, ca, mg, scn |
PDB Entry: 6i4m (more details), 1.87 Å
SCOPe Domain Sequences for d6i4ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i4ma2 c.55.1.0 (A:147-376) automated matches {Plasmodium berghei [TaxId: 5823]}
rttgivldsgdgvthtvpiyegyvlphainrtdmagrdltyymmklftergytftttaer
eivrdikeklcyialdydeelkkseerteeveemyelpdgnlitvgserfrcpealfnps
ligrecpglhitayqsimkcdidirkelynnivlsggttmynyigerltnemtslappsm
kikviapperkysvwiggsilsslstfqkmwitkeeydesgpsivhrkcf
Timeline for d6i4ma2: