Lineage for d6i4ma2 (6i4m A:147-376)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493220Species Plasmodium berghei [TaxId:5823] [370199] (1 PDB entry)
  8. 2493222Domain d6i4ma2: 6i4m A:147-376 [370201]
    Other proteins in same PDB: d6i4mg1, d6i4mg2
    automated match to d1c0fa2
    complexed with adp, ca, mg, scn

Details for d6i4ma2

PDB Entry: 6i4m (more details), 1.87 Å

PDB Description: crystal structure of plasmodium berghei actin ii in the mg-adp state
PDB Compounds: (A:) actin-2

SCOPe Domain Sequences for d6i4ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i4ma2 c.55.1.0 (A:147-376) automated matches {Plasmodium berghei [TaxId: 5823]}
rttgivldsgdgvthtvpiyegyvlphainrtdmagrdltyymmklftergytftttaer
eivrdikeklcyialdydeelkkseerteeveemyelpdgnlitvgserfrcpealfnps
ligrecpglhitayqsimkcdidirkelynnivlsggttmynyigerltnemtslappsm
kikviapperkysvwiggsilsslstfqkmwitkeeydesgpsivhrkcf

SCOPe Domain Coordinates for d6i4ma2:

Click to download the PDB-style file with coordinates for d6i4ma2.
(The format of our PDB-style files is described here.)

Timeline for d6i4ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6i4ma1