SCOPe 2.08: Domain d6i4ma2: 6i4m A:147-376

Lineage for d6i4ma2 (6i4m A:147-376)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Plasmodium berghei [TaxId:5823] [370199] (1 PDB entry)

8. Domain d6i4ma2: 6i4m A:147-376 [370201]
   Other proteins in same PDB: d6i4mg1, d6i4mg2
   automated match to d1c0fa2
   complexed with adp, ca, mg, scn

Details for d6i4ma2

PDB Entry: 6i4m, 1.87 Å

PDB Description: crystal structure of plasmodium berghei actin ii in the mg-adp state

PDB Compounds: (A:) actin-2

SCOPe Domain Sequences for d6i4ma2:

Sequence; same for both SEQRES and ATOM records:

>d6i4ma2 c.55.1.0 (A:147-376) automated matches {Plasmodium berghei [TaxId: 5823]}
rttgivldsgdgvthtvpiyegyvlphainrtdmagrdltyymmklftergytftttaer
eivrdikeklcyialdydeelkkseerteeveemyelpdgnlitvgserfrcpealfnps
ligrecpglhitayqsimkcdidirkelynnivlsggttmynyigerltnemtslappsm
kikviapperkysvwiggsilsslstfqkmwitkeeydesgpsivhrkcf

Timeline for d6i4ma2:

• d6i4ma2 first appeared in SCOPe 2.07