Lineage for d6i4fa2 (6i4f A:148-366)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491727Protein automated matches [226905] (13 species)
    not a true protein
  7. 2491966Species Plasmodium falciparum [TaxId:36329] [336601] (11 PDB entries)
  8. 2491971Domain d6i4fa2: 6i4f A:148-366 [370185]
    Other proteins in same PDB: d6i4fa1, d6i4fg_
    automated match to d3ub5a2
    complexed with adp, atp, btb, ca, cl, k, mg, na, peg; mutant

Details for d6i4fa2

PDB Entry: 6i4f (more details), 1.5 Å

PDB Description: crystal structure of plasmodium falciparum actin i (a272w mutant) in the mg-k-atp/adp state
PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d6i4fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i4fa2 c.55.1.1 (A:148-366) automated matches {Plasmodium falciparum [TaxId: 36329]}
rttgivldsgdgvshtvpiyegyalphaimrldlagrdlteylmkilhergygfstsaek
eivrdikeklcyialnfdeemktseqssdieksyelpdgniitvgnerfrcpealfqpsf
lgkewagihtttfnsikkcdvdirkdlygnivlsggttmyegigerltrdittlapstmk
ikvvapperkysvwiggsilsslstfqqmwitkeeydes

SCOPe Domain Coordinates for d6i4fa2:

Click to download the PDB-style file with coordinates for d6i4fa2.
(The format of our PDB-style files is described here.)

Timeline for d6i4fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6i4fa1
View in 3D
Domains from other chains:
(mouse over for more information)
d6i4fg_