SCOPe 2.08: Domain d6hhna1: 6hhn A:2-104

Lineage for d6hhna1 (6hhn A:2-104)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Formosa agariphila [TaxId:320324] [370162] (1 PDB entry)

8. Domain d6hhna1: 6hhn A:2-104 [370163]
   Other proteins in same PDB: d6hhna2
   automated match to d1x8da1

Details for d6hhna1

PDB Entry: 6hhn, 1.47 Å

PDB Description: crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila

PDB Compounds: (A:) L-rhamnose mutarotase

SCOPe Domain Sequences for d6hhna1:

Sequence, based on SEQRES records:

>d6hhna1 d.58.4.0 (A:2-104) automated matches {Formosa agariphila [TaxId: 320324]}
erlafkmklnkgqkqaykerhdqlwpelkqllkdngvseysifideetntlfafqkvsgh
ggsqdlanneivkkwwdfmadimqvnpdnspvsipleevfyme

Sequence, based on observed residues (ATOM records):

>d6hhna1 d.58.4.0 (A:2-104) automated matches {Formosa agariphila [TaxId: 320324]}
erlafkmklnkgqkqaykerhdqlwpelkqllkdngvseysifideetntlfafqkvsgd
lanneivkkwwdfmadimqvnpdnspvsipleevfyme

Timeline for d6hhna1:

• d6hhna1 first appeared in SCOPe 2.07