Lineage for d6hr2c1 (6hr2 C:17-112)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513278Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2513355Protein Elongin C [54699] (3 species)
  7. 2513358Species Human (Homo sapiens) [TaxId:9606] [54700] (52 PDB entries)
  8. 3070083Domain d6hr2c1: 6hr2 C:17-112 [370145]
    Other proteins in same PDB: d6hr2a_, d6hr2b_, d6hr2c2, d6hr2d_, d6hr2e_, d6hr2f_, d6hr2g2, d6hr2h_
    automated match to d1lm8c_
    complexed with dms, edo, fwz

Details for d6hr2c1

PDB Entry: 6hr2 (more details), 1.76 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca4 and pvhl:elonginc:elonginb
PDB Compounds: (C:) Elongin-C

SCOPe Domain Sequences for d6hr2c1:

Sequence, based on SEQRES records: (download)

>d6hr2c1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d6hr2c1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6hr2c1:

Click to download the PDB-style file with coordinates for d6hr2c1.
(The format of our PDB-style files is described here.)

Timeline for d6hr2c1:

  • d6hr2c1 appears in periodic updates to SCOPe 2.07 starting on 2019-07-20