Lineage for d6haxa_ (6hax A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708234Domain d6haxa_: 6hax A: [370144]
    Other proteins in same PDB: d6haxb_, d6haxc1, d6haxc2, d6haxd_, d6haxe2, d6haxf_, d6haxg1, d6haxg2, d6haxh_
    automated match to d2grca_
    complexed with edo, epe, fwz

Details for d6haxa_

PDB Entry: 6hax (more details), 2.35 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb
PDB Compounds: (A:) Probable global transcription activator SNF2L2

SCOPe Domain Sequences for d6haxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6haxa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkkik
erirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak

SCOPe Domain Coordinates for d6haxa_:

Click to download the PDB-style file with coordinates for d6haxa_.
(The format of our PDB-style files is described here.)

Timeline for d6haxa_: