Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d6hr2f_: 6hr2 F: [370138] Other proteins in same PDB: d6hr2a_, d6hr2c1, d6hr2c2, d6hr2d_, d6hr2e_, d6hr2g1, d6hr2g2, d6hr2h_ automated match to d5t35d_ complexed with dms, edo, fwz |
PDB Entry: 6hr2 (more details), 1.76 Å
SCOPe Domain Sequences for d6hr2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hr2f_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi vrslyedledhpnvqkdlerltqeriahq
Timeline for d6hr2f_: