Lineage for d6hr2f_ (6hr2 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768796Domain d6hr2f_: 6hr2 F: [370138]
    Other proteins in same PDB: d6hr2a_, d6hr2c1, d6hr2c2, d6hr2d_, d6hr2e_, d6hr2g1, d6hr2g2, d6hr2h_
    automated match to d5t35d_
    complexed with dms, edo, fwz

Details for d6hr2f_

PDB Entry: 6hr2 (more details), 1.76 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca4 and pvhl:elonginc:elonginb
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6hr2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hr2f_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
vrslyedledhpnvqkdlerltqeriahq

SCOPe Domain Coordinates for d6hr2f_:

Click to download the PDB-style file with coordinates for d6hr2f_.
(The format of our PDB-style files is described here.)

Timeline for d6hr2f_: