SCOPe 2.08: Domain d6gtja2: 6gtj A:167-340

Lineage for d6gtja2 (6gtj A:167-340)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)

7. Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries)

8. Domain d6gtja2: 6gtj A:167-340 [370136]
   Other proteins in same PDB: d6gtja1
   automated match to d1nifa2
   complexed with cu

Details for d6gtja2

PDB Entry: 6gtj, 1.8 Å

PDB Description: neutron crystal structure for copper nitrite reductase from achromobacter cycloclastes at 1.8 a resolution

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6gtja2:

Sequence; same for both SEQRES and ATOM records:

>d6gtja2 b.6.1.3 (A:167-340) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

Timeline for d6gtja2:

• d6gtja2 first appeared in SCOPe 2.07