Lineage for d6hayc1 (6hay C:17-112)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513278Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2513355Protein Elongin C [54699] (3 species)
  7. 2513358Species Human (Homo sapiens) [TaxId:9606] [54700] (52 PDB entries)
  8. 3070046Domain d6hayc1: 6hay C:17-112 [370108]
    Other proteins in same PDB: d6haya_, d6hayb_, d6hayc2, d6hayd_, d6haye_, d6hayf_, d6hayg2, d6hayh_
    automated match to d1lm8c_
    complexed with edo, epe, fmt, fx8

Details for d6hayc1

PDB Entry: 6hay (more details), 2.24 Å

PDB Description: crystal structure of protac 1 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb
PDB Compounds: (C:) Elongin-C

SCOPe Domain Sequences for d6hayc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hayc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6hayc1:

Click to download the PDB-style file with coordinates for d6hayc1.
(The format of our PDB-style files is described here.)

Timeline for d6hayc1: