Lineage for d6haxe1 (6hax E:1373-1492)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (14 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (766 PDB entries)
  8. 3069988Domain d6haxe1: 6hax E:1373-1492 [370050]
    Other proteins in same PDB: d6haxb_, d6haxc1, d6haxc2, d6haxd_, d6haxe2, d6haxf_, d6haxg1, d6haxg2, d6haxh_
    automated match to d2grca_
    complexed with edo, epe, fwz

Details for d6haxe1

PDB Entry: 6hax (more details), 2.35 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb
PDB Compounds: (E:) Probable global transcription activator SNF2L2

SCOPe Domain Sequences for d6haxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6haxe1 a.29.2.0 (E:1373-1492) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeklspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfk
kikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiakee

SCOPe Domain Coordinates for d6haxe1:

Click to download the PDB-style file with coordinates for d6haxe1.
(The format of our PDB-style files is described here.)

Timeline for d6haxe1:

  • d6haxe1 appears in periodic updates to SCOPe 2.07 starting on 2019-07-20