SCOPe 2.08: Domain d6haxe1: 6hax E:1373-1492

Lineage for d6haxe1 (6hax E:1373-1492)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d6haxe1: 6hax E:1373-1492 [370050]
   Other proteins in same PDB: d6haxb_, d6haxc1, d6haxc2, d6haxd_, d6haxe2, d6haxf_, d6haxg1, d6haxg2, d6haxh_
   automated match to d2grca_
   complexed with edo, epe, fwz

Details for d6haxe1

PDB Entry: 6hax, 2.35 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb

PDB Compounds: (E:) Probable global transcription activator SNF2L2

SCOPe Domain Sequences for d6haxe1:

Sequence; same for both SEQRES and ATOM records:

>d6haxe1 a.29.2.0 (E:1373-1492) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeklspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfk
kikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiakee

Timeline for d6haxe1:

• d6haxe1 first appeared in SCOPe 2.07