Lineage for d1chka_ (1chk A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 29559Family d.2.1.7: Chitosanase [53996] (1 protein)
  6. 29560Protein Endochitosanase [53997] (2 species)
  7. 29563Species Streptomyces sp., strain N174 [TaxId:1931] [53998] (1 PDB entry)
  8. 29564Domain d1chka_: 1chk A: [36999]

Details for d1chka_

PDB Entry: 1chk (more details), 2.4 Å

PDB Description: streptomyces n174 chitosanase ph5.5 298k

SCOP Domain Sequences for d1chka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chka_ d.2.1.7 (A:) Endochitosanase {Streptomyces sp., strain N174}
agaglddphkkeiamelvssaenssldwkaqykyiedigdgrgytggiigfcsgtgdmle
lvqhytdlepgnilakylpalkkvngsashsglgtpftkdwataakdtvfqqaqnderdr
vyfdpavsqakadglralgqfayydaivmhgpgndptsfggirktamkkartpaqggdet
tylngfldarkaamlteaahddtsrvdteqrvflkagnldlnpplkwktygdpyvins

SCOP Domain Coordinates for d1chka_:

Click to download the PDB-style file with coordinates for d1chka_.
(The format of our PDB-style files is described here.)

Timeline for d1chka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1chkb_