SCOPe 2.08: Domain d6gjqe_: 6gjq E:

Lineage for d6gjqe_ (6gjq E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
   Uniprot P13569 389-671

8. Domain d6gjqe_: 6gjq E: [369931]
   Other proteins in same PDB: d6gjqb1, d6gjqb2, d6gjqd1, d6gjqd2, d6gjqf1, d6gjqf2, d6gjqh1, d6gjqh2
   automated match to d2pzga_
   complexed with atp

Details for d6gjqe_

PDB Entry: 6gjq, 2.49 Å

PDB Description: human nbd1 of cftr in complex with nanobody t27

PDB Compounds: (E:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d6gjqe_:

Sequence, based on SEQRES records:

>d6gjqe_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
dinfkiergqllavagstgagktsllmmimgelepsegkikhsgrisfcpqfswimpgti
keniifgvsydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislarav
ykdadlylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililheg
ssyfygtfselqnlq

Sequence, based on observed residues (ATOM records):

>d6gjqe_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
dinfkiergqllavagstgagktsllmmimgelepsrisfcpqfswimpgtikeniifgv
sydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykdadlyl
ldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfygtf
selqnlq

Timeline for d6gjqe_:

• d6gjqe_ first appeared in SCOPe 2.07