Lineage for d6go3a1 (6go3 A:148-242)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329042Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329269Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 2329270Protein automated matches [254482] (3 species)
    not a true protein
  7. 2329289Species Mouse (Mus musculus) [TaxId:10090] [255236] (31 PDB entries)
  8. 2329301Domain d6go3a1: 6go3 A:148-242 [369897]
    Other proteins in same PDB: d6go3a2, d6go3a3
    automated match to d1jmsa1

Details for d6go3a1

PDB Entry: 6go3 (more details), 2.2 Å

PDB Description: tdt chimera (loop1 of pol mu) - apoenzyme
PDB Compounds: (A:) DNA nucleotidylexotransferase,DNA-directed DNA/RNA polymerase mu,DNA nucleotidylexotransferase

SCOPe Domain Sequences for d6go3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6go3a1 a.60.6.0 (A:148-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavln

SCOPe Domain Coordinates for d6go3a1:

Click to download the PDB-style file with coordinates for d6go3a1.
(The format of our PDB-style files is described here.)

Timeline for d6go3a1: