Lineage for d6go4a3 (6go4 A:303-511)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3006901Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 3007143Protein automated matches [254484] (3 species)
    not a true protein
  7. 3007149Species Mouse (Mus musculus) [TaxId:10090] [256295] (30 PDB entries)
  8. 3007151Domain d6go4a3: 6go4 A:303-511 [369896]
    Other proteins in same PDB: d6go4a1, d6go4a2
    automated match to d1jmsa4
    protein/DNA complex; complexed with dct, mg, na

Details for d6go4a3

PDB Entry: 6go4 (more details), 1.96 Å

PDB Description: tdt chimera (loop1 of pol mu) - binary complex with ddctp
PDB Compounds: (A:) DNA nucleotidylexotransferase,DNA-directed DNA/RNA polymerase mu,DNA nucleotidylexotransferase

SCOPe Domain Sequences for d6go4a3:

Sequence, based on SEQRES records: (download)

>d6go4a3 d.218.1.2 (A:303-511) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllyhqyhrshladsahnlrqrsstmdvfersfcilkldhgrvhseksg
qqegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrt
krvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records): (download)

>d6go4a3 d.218.1.2 (A:303-511) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllyhqyhrshladsahnlrstmdvfersfcilkldhgrvhsekegkgw
kairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrvflea
eseeeifahlgldyiepwerna

SCOPe Domain Coordinates for d6go4a3:

Click to download the PDB-style file with coordinates for d6go4a3.
(The format of our PDB-style files is described here.)

Timeline for d6go4a3: