Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries) |
Domain d6gjub1: 6gju B:6-118 [369879] Other proteins in same PDB: d6gjub2, d6gjuc2 automated match to d4nbzb_ complexed with gol, peg |
PDB Entry: 6gju (more details), 2.6 Å
SCOPe Domain Sequences for d6gjub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gjub1 b.1.1.0 (B:6-118) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqaggslrlscaasgstfaiiamgwyrqapgkqrelvavistgdtryadsvkgr ftisrdnakntvylqmdslrpedtavyycnaavqvrdyrnywgqgtqvtvssa
Timeline for d6gjub1: