SCOPe 2.08: Domain d6gjqh1: 6gjq H:6-121

Lineage for d6gjqh1 (6gjq H:6-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d6gjqh1: 6gjq H:6-121 [369877]
   Other proteins in same PDB: d6gjqa_, d6gjqb2, d6gjqd2, d6gjqe_, d6gjqf2, d6gjqg_, d6gjqh2
   automated match to d4nbzb_
   complexed with atp

Details for d6gjqh1

PDB Entry: 6gjq, 2.49 Å

PDB Description: human nbd1 of cftr in complex with nanobody t27

PDB Compounds: (H:) Nanobody T27

SCOPe Domain Sequences for d6gjqh1:

Sequence; same for both SEQRES and ATOM records:

>d6gjqh1 b.1.1.0 (H:6-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
esgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnyadfveg
rftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvss

Timeline for d6gjqh1:

• d6gjqh1 first appeared in SCOPe 2.07