SCOPe 2.08: Domain d6glwd1: 6glw D:2-111

Lineage for d6glwd1 (6glw D:2-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d6glwd1: 6glw D:2-111 [369874]
   Other proteins in same PDB: d6glwa_, d6glwb_, d6glwc_, d6glwd2, d6glwh_, d6glwl2
   automated match to d1aqkl1
   complexed with act, pg4

Details for d6glwd1

PDB Entry: 6glw, 1.9 Å

PDB Description: structure of galectin-10 in complex with the fab fragment of a charcot-leyden crystal solubilizing antibody, 1d11

PDB Compounds: (D:) Fab 1D11 - Light chain

SCOPe Domain Sequences for d6glwd1:

Sequence; same for both SEQRES and ATOM records:

>d6glwd1 b.1.1.0 (D:2-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
svltqppsvsgspgetvtiscagtssdvgygnyvswyqqlpgmaprlliyevnkrasgit
drfsgsksgntasltisglqsedegdyycasyrssnnavfgggthltvlg

Timeline for d6glwd1:

• d6glwd1 first appeared in SCOPe 2.07