Lineage for d1lspa_ (1lsp A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1398814Family d.2.1.5: G-type lysozyme [53987] (2 proteins)
  6. 1398815Protein Lysozyme [53988] (2 species)
  7. 1398816Species Australian black swan (Cygnus atratus) [TaxId:8868] [53990] (2 PDB entries)
  8. 1398818Domain d1lspa_: 1lsp A: [36987]
    complexed with bul

Details for d1lspa_

PDB Entry: 1lsp (more details), 2.45 Å

PDB Description: the crystal structure of a bulgecin-inhibited g-type lysozyme from the egg-white of the australian black swan. a comparison of the binding of bulgecin to three muramidases
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1lspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lspa_ d.2.1.5 (A:) Lysozyme {Australian black swan (Cygnus atratus) [TaxId: 8868]}
rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
kqhgy

SCOPe Domain Coordinates for d1lspa_:

Click to download the PDB-style file with coordinates for d1lspa_.
(The format of our PDB-style files is described here.)

Timeline for d1lspa_: