Lineage for d1lsp__ (1lsp -)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 406470Family d.2.1.5: G-type lysozyme [53987] (1 protein)
  6. 406471Protein Lysozyme [53988] (2 species)
  7. 406472Species Australian black swan (Cygnus atratus) [TaxId:8868] [53990] (2 PDB entries)
  8. 406474Domain d1lsp__: 1lsp - [36987]
    complexed with bul

Details for d1lsp__

PDB Entry: 1lsp (more details), 2.45 Å

PDB Description: the crystal structure of a bulgecin-inhibited g-type lysozyme from the egg-white of the australian black swan. a comparison of the binding of bulgecin to three muramidases

SCOP Domain Sequences for d1lsp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lsp__ d.2.1.5 (-) Lysozyme {Australian black swan (Cygnus atratus)}
rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
kqhgy

SCOP Domain Coordinates for d1lsp__:

Click to download the PDB-style file with coordinates for d1lsp__.
(The format of our PDB-style files is described here.)

Timeline for d1lsp__: