Lineage for d1lsp__ (1lsp -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.5: G-type lysozyme [53987] (1 protein) Protein Lysozyme [53988] (2 species) 
Species Australian black swan (Cygnus atratus) [TaxId:8868] [53990] (2 PDB entries) 
Domain d1lsp__: 1lsp - [36987]
Details for d1lsp__
PDB Entry: 1lsp (more details), 2.45 Å
PDB Description: the crystal structure of a bulgecin-inhibited g-type lysozyme from the egg-white of the australian black swan. a comparison of the binding of bulgecin to three muramidases
SCOP Domain Sequences for d1lsp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lsp__ d.2.1.5 (-) Lysozyme {Australian black swan (Cygnus atratus)}
rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
kqhgy
SCOP Domain Coordinates for d1lsp__:
Click to download the PDB-style file with coordinates for d1lsp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lsp__:
- d1lsp__ appears in SCOP 1.57
- d1lsp__ appears in the current release, SCOPe 2.08, called d1lspa_
View in 3D