Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (33 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [329909] (4 PDB entries) |
Domain d6ds8b_: 6ds8 B: [369742] automated match to d4nl5b_ complexed with cl, mnh; mutant |
PDB Entry: 6ds8 (more details), 2.4 Å
SCOPe Domain Sequences for d6ds8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ds8b_ d.58.4.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} pvvkinaievpagagpelekrfahsahavenspgflgfqllrpvkgeeryfvvthwesde afqawangpaiaahaghranpvatgasllefevvldvgg
Timeline for d6ds8b_: