Lineage for d6dn0b_ (6dn0 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (22 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (237 PDB entries)
  8. 3069675Domain d6dn0b_: 6dn0 B: [369737]
    Other proteins in same PDB: d6dn0a_, d6dn0c_
    automated match to d4x4xb_
    complexed with fmt; mutant

Details for d6dn0b_

PDB Entry: 6dn0 (more details), 2 Å

PDB Description: retrofitted antibodies with stabilizing mutations: herceptin scfv mutant with vh k30d and vl s52d.
PDB Compounds: (B:) Human Variable Light Chain of Herceptin containing VL mutation S52D

SCOPe Domain Sequences for d6dn0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dn0b_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysadflysgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkvei

SCOPe Domain Coordinates for d6dn0b_:

Click to download the PDB-style file with coordinates for d6dn0b_.
(The format of our PDB-style files is described here.)

Timeline for d6dn0b_: