Lineage for d6dn0a_ (6dn0 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1264 PDB entries)
  8. 3069670Domain d6dn0a_: 6dn0 A: [369732]
    Other proteins in same PDB: d6dn0b_, d6dn0d_
    automated match to d4x4ya_
    complexed with fmt; mutant

Details for d6dn0a_

PDB Entry: 6dn0 (more details), 2 Å

PDB Description: retrofitted antibodies with stabilizing mutations: herceptin scfv mutant with vh k30d and vl s52d.
PDB Compounds: (A:) Human Variable Heavy Chain of Herceptin containing VH mutation K30D

SCOPe Domain Sequences for d6dn0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dn0a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfniddtyihwvrqapgkglewvariyptngytry
adsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvs

SCOPe Domain Coordinates for d6dn0a_:

Click to download the PDB-style file with coordinates for d6dn0a_.
(The format of our PDB-style files is described here.)

Timeline for d6dn0a_: