Lineage for d6d7kg_ (6d7k G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699320Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 2699321Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)
  6. 2699383Protein automated matches [369668] (2 species)
    not a true protein
  7. 2699384Species Methylosinus sporium [TaxId:428] [369669] (1 PDB entry)
  8. 2699386Domain d6d7kg_: 6d7k G: [369670]
    Other proteins in same PDB: d6d7ka_, d6d7ke_
    automated match to d1mhyg_
    complexed with fe, fmt, hez

Details for d6d7kg_

PDB Entry: 6d7k (more details), 2.6 Å

PDB Description: complex structure of methane monooxygenase hydroxylase in complex with inhibitory subunit
PDB Compounds: (G:) Methane monooxygenase hydroxylase, MmoZ

SCOPe Domain Sequences for d6d7kg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d7kg_ a.23.3.1 (G:) automated matches {Methylosinus sporium [TaxId: 428]}
krepihenstrtewegkiaklnsvdqatkfiqdfrvaysspfrksydldvdyqyierkie
erlsvlkteklsvadlvtkattgedaaaveaawiakmkaaeskyaaerihiefrqlykpp
vlpvnvflrtdaalgtilmelrntdyyatpleglrkergvkvlhlqa

SCOPe Domain Coordinates for d6d7kg_:

Click to download the PDB-style file with coordinates for d6d7kg_.
(The format of our PDB-style files is described here.)

Timeline for d6d7kg_: