Class a: All alpha proteins [46456] (290 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) duplication: consists of two domains of this fold automatically mapped to Pfam PF02964 |
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins) |
Protein automated matches [369668] (2 species) not a true protein |
Species Methylosinus sporium [TaxId:428] [369669] (1 PDB entry) |
Domain d6d7kg_: 6d7k G: [369670] Other proteins in same PDB: d6d7ka_, d6d7ke_ automated match to d1mhyg_ complexed with fe, fmt, hez |
PDB Entry: 6d7k (more details), 2.6 Å
SCOPe Domain Sequences for d6d7kg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d7kg_ a.23.3.1 (G:) automated matches {Methylosinus sporium [TaxId: 428]} krepihenstrtewegkiaklnsvdqatkfiqdfrvaysspfrksydldvdyqyierkie erlsvlkteklsvadlvtkattgedaaaveaawiakmkaaeskyaaerihiefrqlykpp vlpvnvflrtdaalgtilmelrntdyyatpleglrkergvkvlhlqa
Timeline for d6d7kg_: