Lineage for d6cnea1 (6cne A:3-56)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503865Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2503866Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2503891Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2503895Species Streptococcus sp. [TaxId:1320] [193546] (12 PDB entries)
  8. 3069576Domain d6cnea1: 6cne A:3-56 [369638]
    Other proteins in same PDB: d6cnea2, d6cneb2
    automated match to d2qmta_
    complexed with mpd, po4; mutant

Details for d6cnea1

PDB Entry: 6cne (more details), 1.2 Å

PDB Description: selenomethionine variant (v29sem) of protein gb1
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d6cnea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cnea1 d.15.7.1 (A:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
ykmilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

SCOPe Domain Coordinates for d6cnea1:

Click to download the PDB-style file with coordinates for d6cnea1.
(The format of our PDB-style files is described here.)

Timeline for d6cnea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6cnea2