Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species) |
Species Streptococcus sp. [TaxId:1320] [193546] (13 PDB entries) |
Domain d6cneb1: 6cne B:3-56 [369628] Other proteins in same PDB: d6cnea2, d6cneb2 automated match to d2qmta_ complexed with mpd, po4 |
PDB Entry: 6cne (more details), 1.2 Å
SCOPe Domain Sequences for d6cneb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cneb1 d.15.7.1 (B:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]} ykmilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte
Timeline for d6cneb1: