SCOPe 2.08: Domain d6cneb1: 6cne B:3-56

Lineage for d6cneb1 (6cne B:3-56)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp. [TaxId:1320] [193546] (13 PDB entries)

8. Domain d6cneb1: 6cne B:3-56 [369628]
   Other proteins in same PDB: d6cnea2, d6cneb2
   automated match to d2qmta_
   complexed with mpd, po4

Details for d6cneb1

PDB Entry: 6cne, 1.2 Å

PDB Description: selenomethionine variant (v29sem) of protein gb1

PDB Compounds: (B:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d6cneb1:

Sequence; same for both SEQRES and ATOM records:

>d6cneb1 d.15.7.1 (B:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
ykmilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

Timeline for d6cneb1:

• d6cneb1 first appeared in SCOPe 2.07