SCOPe 2.08: Domain d6a9na2: 6a9n A:185-332

Lineage for d6a9na2 (6a9n A:185-332)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Cutibacterium acnes [TaxId:1747] [369559] (1 PDB entry)

8. Domain d6a9na2: 6a9n A:185-332 [369561]
   automated match to d1mzja2
   complexed with gol, k

Details for d6a9na2

PDB Entry: 6a9n, 2.1 Å

PDB Description: crystal structure of kas iii from propionibacterium acnes

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d6a9na2:

Sequence; same for both SEQRES and ATOM records:

>d6a9na2 c.95.1.0 (A:185-332) automated matches {Cutibacterium acnes [TaxId: 1747]}
gpvvwgsrsdqlktieledwptasadpnkihplirmegravfkwamtdvakraaeaiaea
gitpadldvfiphqandritdvvsrhlklpesvtvchdiadmgntsaasvpiaidrmlqr
gqahsgdlaliigfgaglvyagqvirlp

Timeline for d6a9na2:

• d6a9na2 first appeared in SCOPe 2.07