Lineage for d6qnal1 (6qna L:3-109)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365457Species Cow (Bos taurus) [TaxId:9913] [226022] (16 PDB entries)
  8. 2365502Domain d6qnal1: 6qna L:3-109 [369436]
    automated match to d4k3el1
    complexed with gol

Details for d6qnal1

PDB Entry: 6qna (more details), 2.62 Å

PDB Description: structure of bovine anti-rsv hybrid fab b13hc-b4lc
PDB Compounds: (L:) B4 light chain

SCOPe Domain Sequences for d6qnal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qnal1 b.1.1.0 (L:3-109) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvpdr
fsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmg

SCOPe Domain Coordinates for d6qnal1:

Click to download the PDB-style file with coordinates for d6qnal1.
(The format of our PDB-style files is described here.)

Timeline for d6qnal1: