Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226022] (16 PDB entries) |
Domain d6qnab1: 6qna B:3-109 [369425] automated match to d4k3el1 complexed with gol |
PDB Entry: 6qna (more details), 2.62 Å
SCOPe Domain Sequences for d6qnab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qnab1 b.1.1.0 (B:3-109) automated matches {Cow (Bos taurus) [TaxId: 9913]} vltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvpdr fsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmg
Timeline for d6qnab1: