SCOPe 2.08: Domain d6jwkb1: 6jwk B:81-212

Lineage for d6jwkb1 (6jwk B:81-212)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [369341] (1 PDB entry)

8. Domain d6jwkb1: 6jwk B:81-212 [369349]
   automated match to d4kaea2
   complexed with gol, so4

Details for d6jwkb1

PDB Entry: 6jwk, 1.86 Å

PDB Description: crystal structure of maleylpyruvate isomerase from pseudomonas aeruginosa pao1

PDB Compounds: (B:) Probable glutathione S-transferase

SCOPe Domain Sequences for d6jwkb1:

Sequence; same for both SEQRES and ATOM records:

>d6jwkb1 a.45.1.0 (B:81-212) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
rlipldplhraqalelallvacdihplnnvrvlkyltqvlgidaedrqrwyahwvaegla
aaetllnrhrrgaffagaaagivecclvpqlanarrmgcdlapypallelegrclaleaf
qrasperqpdyl

Timeline for d6jwkb1:

• d6jwkb1 first appeared in SCOPe 2.07