Class b: All beta proteins [48724] (178 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186915] (26 PDB entries) |
Domain d6gjxb_: 6gjx B: [369275] automated match to d2x2aa_ complexed with cit, edo, f2e |
PDB Entry: 6gjx (more details), 1.41 Å
SCOPe Domain Sequences for d6gjxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gjxb_ b.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls
Timeline for d6gjxb_: