Lineage for d6gjxa_ (6gjx A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416500Protein automated matches [190077] (21 species)
    not a true protein
  7. 2416525Species Human (Homo sapiens) [TaxId:9606] [186915] (26 PDB entries)
  8. 2416536Domain d6gjxa_: 6gjx A: [369271]
    automated match to d2x2aa_
    complexed with cit, edo, f2e

Details for d6gjxa_

PDB Entry: 6gjx (more details), 1.41 Å

PDB Description: scaffold-ligand complex
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase F, mitochondrial

SCOPe Domain Sequences for d6gjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gjxa_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

SCOPe Domain Coordinates for d6gjxa_:

Click to download the PDB-style file with coordinates for d6gjxa_.
(The format of our PDB-style files is described here.)

Timeline for d6gjxa_:

  • d6gjxa_ is new in SCOPe 2.07-stable
  • d6gjxa_ does not appear in SCOPe 2.08