Lineage for d6io1b_ (6io1 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (141 species)
    not a true protein
  7. 3069067Species Thermomicrobium roseum [TaxId:309801] [369129] (1 PDB entry)
  8. 3069068Domain d6io1b_: 6io1 B: [369130]
    automated match to d5g09b_
    complexed with pmp

Details for d6io1b_

PDB Entry: 6io1 (more details), 1.8 Å

PDB Description: crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum
PDB Compounds: (B:) Aminotransferase, class III

SCOPe Domain Sequences for d6io1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6io1b_ c.67.1.0 (B:) automated matches {Thermomicrobium roseum [TaxId: 309801]}
etwnaaelvakdiahhlhpltnlyqlrregplvlvrgegvwvwdaegkryldgfaglwnv
nighgrrelaeaareqmervafvptffglaspptielaarlaelfpgpldhfqftsggae
snetaikiaryywwlkgqpervkilsrrmayhgiamgalsatgvpaywegfgprppgfih
ltapykyrfgegltdeefvarlvqeleetieregsetiaafigepvqgaggvvvppdgyw
paiaavlrkygillildevitgfgrtgtlfgmqqygvqpdivtfakgitsgyvplggvgv
sdeiaetlasadrvfmhgftysghpvacavalrnldillaerlwenaaasgayllqelkr
leerpyvgevrgkglmllvevvrdkaskekfppefklgpkleaatrrrgiivrctpdgiv
mappltisraecdvliegvaaalsdvld

SCOPe Domain Coordinates for d6io1b_:

Click to download the PDB-style file with coordinates for d6io1b_.
(The format of our PDB-style files is described here.)

Timeline for d6io1b_:

  • d6io1b_ appears in periodic updates to SCOPe 2.07 starting on 2019-05-23