Lineage for d6i9pa_ (6i9p A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702633Species Lithobates catesbeiana [TaxId:8400] [323613] (9 PDB entries)
  8. 2702639Domain d6i9pa_: 6i9p A: [369128]
    automated match to d3shxa_
    complexed with cl, mg

Details for d6i9pa_

PDB Entry: 6i9p (more details), 1.25 Å

PDB Description: iron-free state of rana catesbeiana h' ferritin variant h54n
PDB Compounds: (A:) Ferritin, middle subunit

SCOPe Domain Sequences for d6i9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i9pa_ a.25.1.1 (A:) automated matches {Lithobates catesbeiana [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkensheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes

SCOPe Domain Coordinates for d6i9pa_:

Click to download the PDB-style file with coordinates for d6i9pa_.
(The format of our PDB-style files is described here.)

Timeline for d6i9pa_: