Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [343222] (2 PDB entries) |
Domain d6i2pb_: 6i2p B: [369127] Other proteins in same PDB: d6i2pe_ automated match to d3orta_ complexed with acp, mg, so4; mutant |
PDB Entry: 6i2p (more details), 2.37 Å
SCOPe Domain Sequences for d6i2pb_:
Sequence, based on SEQRES records: (download)
>d6i2pb_ d.144.1.7 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ttpshlsdryelgeilgfggmsevhlardlrehrdvavkvlradlardpsfylrfrreaq naaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviad acqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaq ylspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarhe glsadldavvlkalaknpenryqtaaemradlvrvh
>d6i2pb_ d.144.1.7 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ttpshlsdryelgeilgfggmsevhlardlrehrdvavkvlradlardpsfylrfrreaq naaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviad acqalnfshqngiihrdvkpanimisatnavkvmdfgiansvtqtaataqylspeqargd svdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavv lkalaknpenryqtaaemradlvrvh
Timeline for d6i2pb_: