![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
![]() | Protein automated matches [190914] (14 species) not a true protein |
![]() | Species Caulobacter vibrioides [TaxId:190650] [369058] (1 PDB entry) |
![]() | Domain d6gwkc_: 6gwk C: [369107] automated match to d3inzf_ |
PDB Entry: 6gwk (more details), 2.15 Å
SCOPe Domain Sequences for d6gwkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gwkc_ b.38.1.0 (C:) automated matches {Caulobacter vibrioides [TaxId: 190650]} nlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistimp aqpvqlyep
Timeline for d6gwkc_: