Lineage for d6gwkr_ (6gwk R:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2381067Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2381068Protein automated matches [190914] (14 species)
    not a true protein
  7. 3068996Species Caulobacter vibrioides [TaxId:190650] [369058] (1 PDB entry)
  8. 3069042Domain d6gwkr_: 6gwk R: [369104]
    automated match to d3inzf_

Details for d6gwkr_

PDB Entry: 6gwk (more details), 2.15 Å

PDB Description: the crystal structure of hfq from caulobacter crescentus
PDB Compounds: (R:) RNA-binding protein Hfq

SCOPe Domain Sequences for d6gwkr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwkr_ b.38.1.0 (R:) automated matches {Caulobacter vibrioides [TaxId: 190650]}
kqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaisti
mpaqpvqlyep

SCOPe Domain Coordinates for d6gwkr_:

Click to download the PDB-style file with coordinates for d6gwkr_.
(The format of our PDB-style files is described here.)

Timeline for d6gwkr_: