Lineage for d6dguc_ (6dgu C:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013606Species Citrobacter freundii [TaxId:546] [235913] (4 PDB entries)
  8. 3013617Domain d6dguc_: 6dgu C: [369062]
    automated match to d3znwb_

Details for d6dguc_

PDB Entry: 6dgu (more details), 2.69 Å

PDB Description: per-2 class a extended-spectrum beta-lactamase crystal structure at 2.69 angstrom resolution
PDB Compounds: (C:) Beta-lactamase

SCOPe Domain Sequences for d6dguc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dguc_ e.3.1.1 (C:) automated matches {Citrobacter freundii [TaxId: 546]}
spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
lvavfvkdsaesertneaiiaqvaqaayqfelkkl

SCOPe Domain Coordinates for d6dguc_:

Click to download the PDB-style file with coordinates for d6dguc_.
(The format of our PDB-style files is described here.)

Timeline for d6dguc_: