Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [190161] (29 species) not a true protein |
Species Citrobacter freundii [TaxId:546] [235913] (4 PDB entries) |
Domain d6dguc_: 6dgu C: [369062] automated match to d3znwb_ |
PDB Entry: 6dgu (more details), 2.69 Å
SCOPe Domain Sequences for d6dguc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dguc_ e.3.1.1 (C:) automated matches {Citrobacter freundii [TaxId: 546]} spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl lvavfvkdsaesertneaiiaqvaqaayqfelkkl
Timeline for d6dguc_: