SCOPe 2.08: Domain d6ggca_: 6ggc A:

Lineage for d6ggca_ (6ggc A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries)

8. Domain d6ggca_: 6ggc A: [369051]
   automated match to d2feja_
   protein/DNA complex; complexed with edo, exn, gol, zn; mutant

Details for d6ggca_

PDB Entry: 6ggc, 1.24 Å

PDB Description: p53 cancer mutant y220c in complex with small-molecule stabilizer pk9320

PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d6ggca_:

Sequence; same for both SEQRES and ATOM records:

>d6ggca_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlrkk

Timeline for d6ggca_:

• d6ggca_ first appeared in SCOPe 2.07