SCOPe 2.08: Domain d6e4xy2: 6e4x Y:103-208

Lineage for d6e4xy2 (6e4x Y:103-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6e4xy2: 6e4x Y:103-208 [369043]
   Other proteins in same PDB: d6e4xb_, d6e4xy1, d6e4xz1, d6e4xz2
   automated match to d1dn0a2
   complexed with gol, nag

Details for d6e4xy2

PDB Entry: 6e4x, 2.25 Å

PDB Description: human antibody s5v2-29 in complex with influenza hemagglutinin a/texas/50/2012 (h3n2)

PDB Compounds: (Y:) S5V2-29 light chain

SCOPe Domain Sequences for d6e4xy2:

Sequence; same for both SEQRES and ATOM records:

>d6e4xy2 b.1.1.2 (Y:103-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d6e4xy2:

• d6e4xy2 first appeared in SCOPe 2.07