Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6e4xy2: 6e4x Y:103-208 [369043] Other proteins in same PDB: d6e4xb_, d6e4xy1, d6e4xz1, d6e4xz2 automated match to d1dn0a2 complexed with gol, nag |
PDB Entry: 6e4x (more details), 2.25 Å
SCOPe Domain Sequences for d6e4xy2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e4xy2 b.1.1.2 (Y:103-208) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d6e4xy2: