Lineage for d1dyc__ (1dyc -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein) Protein Phage T4 lysozyme [53982] (1 species) Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries) 
Domain d1dyc__: 1dyc - [36903]
Details for d1dyc__
PDB Entry: 1dyc (more details), 2.1 Å
PDB Description: determination of alpha-helix propensity within the context of a folded protein: sites 44 and 131 in bacteriophage t4 lysozyme
SCOP Domain Sequences for d1dyc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dyc__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaainlaksrwynqtpnrakrvittfrtgtwdayk
SCOP Domain Coordinates for d1dyc__:
Click to download the PDB-style file with coordinates for d1dyc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dyc__:
- d1dyc__ appears in SCOP 1.57
- d1dyc__ appears in the current release, SCOPe 2.08, called d1dyca_
View in 3D