Lineage for d6osra1 (6osr A:4-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776350Species Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId:506347] [368936] (1 PDB entry)
  8. 2776351Domain d6osra1: 6osr A:4-324 [368981]
    Other proteins in same PDB: d6osra2, d6osrb2, d6osrb3, d6osrc2, d6osrd2, d6osre2, d6osrf2
    automated match to d4wsrd1
    complexed with edo, k, na, nag

Details for d6osra1

PDB Entry: 6osr (more details), 2.55 Å

PDB Description: crystal structure of influenza hemagglutinin from strain a/melbourne/1/1946(h1n1)
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6osra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6osra1 b.19.1.0 (A:4-324) automated matches {Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId: 506347]}
ticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagwi
lgnpecdsllpasswsyivetpnskngicypgdfidyeelreqlssvssferfeifpkes
swpkhsttkgvtaacshagkssfyrnllwltkkedsypklsnsyvnkkgkevlvlwgvhh
pssskeqqtlyqnenayvsvvssnynrrfipeiaerpevkdqagrinyywtllepgdtii
feangnlvapwyafalsrgfgsgiitsnasmhecntkcqtpqgainsslpfqnihpvtig
ecpkyvksaklrmvtglrnip

SCOPe Domain Coordinates for d6osra1:

Click to download the PDB-style file with coordinates for d6osra1.
(The format of our PDB-style files is described here.)

Timeline for d6osra1: