Lineage for d6mymb1 (6mym B:8-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775578Species Influenza a virus (a/philippines/2/1982(h3n2)) [TaxId:382825] [368906] (1 PDB entry)
  8. 2775580Domain d6mymb1: 6mym B:8-324 [368956]
    Other proteins in same PDB: d6myma2, d6mymb2, d6mymc2
    automated match to d4we4a_
    complexed with bma, nag

Details for d6mymb1

PDB Entry: 6mym (more details), 2.45 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/phillipines/2/1982 (h3n2)
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6mymb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mymb1 b.19.1.2 (B:8-324) Hemagglutinin {Influenza a virus (a/philippines/2/1982(h3n2)) [TaxId: 382825]}
nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli
dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnw
tgvtqsggsytckrgsnnsffsrlnwlyeseskypvlnvtmpnngkfdklyiwgihhpst
dkeqtnlyirasgrvtvstkrsqqtvipnigsrpwvrglssrisiywtivkpgdillins
tgnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpr
yvkqntlklatgmrnvp

SCOPe Domain Coordinates for d6mymb1:

Click to download the PDB-style file with coordinates for d6mymb1.
(The format of our PDB-style files is described here.)

Timeline for d6mymb1: